| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Steroid sulfatase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Steroid sulfatase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Steroid sulfatase. This antibody reacts with human. The Steroid sulfatase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to STS(steroid sulfatase (microsomal), isozyme S) The peptide sequence was selected from the middle region of STS. Peptide sequence EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY. |
|---|
| Other Names | ARSC1ES, ARSCsteroid sulfatase (microsomal), arylsulfatase C, isozyme S, Arylsulfatase C, ASC, EC 3.1.6, EC 3.1.6.2, estrone sulfatase, SSDD, Steroid sulfatase, steroid sulfatase (microsomal), isozyme S, steryl-sulfatase, Steryl-sulfate sulfohydrolase, XLI |
|---|
| Gene, Accession # | STS, Gene ID: 412, Accession: P08842, SwissProt: P08842 |
|---|
| Catalog # | NBP1-69686 |
|---|
| Price | |
|---|
| Order / More Info | Steroid sulfatase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|