| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ST6GALNAC4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ST6GALNAC4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST6GALNAC4. This antibody reacts with human. The ST6GALNAC4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ST6GALNAC4(ST6 -N-acetylgalactosaminide alpha-2,6-sialyltransferase 4) The peptide sequence was selected from the middle region of ST6GALNAC4. Peptide sequence QLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLST |
|---|
| Other Names | EC 2.4.99, EC 2.4.99.7, NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6-sialyltransferase, NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6-sialyltransferase IV, Sialyltransferase 3C, Sialyltransferase 7D, sialyltransferase 7D((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase), SIAT3-C, SIAT3C6-sialyltransferasealpha2,6-sialyltransferase, SIAT7-D, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 4, ST6GalNAc IV, ST6GalNAcIV |
|---|
| Gene, Accession # | ST6GALNAC4, Gene ID: 27090, Accession: Q9H4F1, SwissProt: Q9H4F1 |
|---|
| Catalog # | NBP1-62417 |
|---|
| Price | |
|---|
| Order / More Info | ST6GALNAC4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|