| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A. This antibody reacts with human. The ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ST3GAL1(ST3 beta-galactoside alpha-2,3-sialyltransferase 1) The peptide sequence was selected from the C terminal of ST3GAL1. Peptide sequence YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN. |
|---|
| Other Names | Alpha 2,3-ST 1, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1, DKFZp666E036, DKFZp779K2051, EC 2.4.99, EC 2.4.99.4, Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase, Gal-NAc6S, Sialyltransferase 4A, sialyltransferase 4A (beta-galactosidase alpha-2,3-sialytransferase), sialyltransferase 4A (beta-galactoside alpha-2,3-sialyltransferase), sialyltransferase 4A (beta-galactoside alpha-2,3-sialytransferase), SIAT4, SIAT4A, SIAT4-A, SIATFLFLJ36548, ST3 beta-galactoside alpha-2,3-sialyltransferase 1, ST3Gal I, ST3GalA.1MGC9183, ST3GalI, ST3GalIA, ST3GalIA1,Beta-galactoside alpha-2,3-sialyltransferase 1, ST3OST3GalA |
|---|
| Gene, Accession # | ST3GAL1, Gene ID: 6482, Accession: Q11201, SwissProt: Q11201 |
|---|
| Catalog # | NBP1-62540 |
|---|
| Price | |
|---|
| Order / More Info | ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|