| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | STCH |
|---|
| Clone | 1H8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STCH Antibody (1H8) from Novus Biologicals is a mouse monoclonal antibody to STCH. This antibody reacts with human, mouse. The STCH Antibody (1H8) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | STCH (NP_008879.3 375 a.a. - 470 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGSWPLQVSALEIPNKHLQKTNF |
|---|
| Other Names | heat shock 70 kDa protein 13, heat shock protein 70kDa family, member 13, microsomal stress 70 protein ATPase core, Microsomal stress-70 protein ATPase core, STCHStress-70 protein chaperone microsome-associated 60 kDa protein, stress 70 protein chaperone, microsome-associated, 60kD, stress 70 protein chaperone, microsome-associated, 60kDa |
|---|
| Gene, Accession # | HSPA13, Gene ID: 6782, Accession: NP_008879, SwissProt: NP_008879 |
|---|
| Catalog # | H00006782-M02 |
|---|
| Price | |
|---|
| Order / More Info | STCH Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|