| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CKII alpha prime polypeptide |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CKII alpha prime polypeptide Antibody from Novus Biologicals is a rabbit polyclonal antibody to CKII alpha prime polypeptide. This antibody reacts with human. The CKII alpha prime polypeptide Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CKII alpha prime polypeptide antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('EAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR',) |
|---|
| Other Names | casein kinase 2, alpha prime polypeptide, casein kinase II subunit alpha', CK II alpha', CK2A2, CSNK2A1, EC 2.7.11, EC 2.7.11.1, FLJ43934 |
|---|
| Gene, Accession # | CSNK2A2, Gene ID: 1459 |
|---|
| Catalog # | NBP2-57977 |
|---|
| Price | |
|---|
| Order / More Info | CKII alpha prime polypeptide Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|