| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CKIP-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CKIP-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CKIP-1. This antibody reacts with human. The CKIP-1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PLEKHO1 (pleckstrin homology domain containing, family O member 1) The peptide sequence was selected from the N terminal of PLEKHO1. Peptide sequence MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG. |
|---|
| Other Names | 2810052M02Rik, Casein kinase 2-interacting protein 1, C-Jun-binding protein, CK2 interacting protein 1; HQ0024c protein, CK2-interacting protein 1, CKIP1, CKIP-1PH domain-containing family O member 1, JBP, OC120, Osteoclast maturation-associated gene 120 protein, pleckstrin homology domain containing, family O member 1, pleckstrin homology domain-containing family O member 1 |
|---|
| Gene, Accession # | PLEKHO1, Gene ID: 51177, Accession: Q53GL0, SwissProt: Q53GL0 |
|---|
| Catalog # | NBP1-56986 |
|---|
| Price | |
|---|
| Order / More Info | CKIP-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|