| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cadherin-17 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cadherin-17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cadherin-17. This antibody reacts with human. The Cadherin-17 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Cadherin-17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDREEKDAYVFYAVAKDEYGKPLSYPLEIHVKVK |
|---|
| Other Names | cadherin, cadherin 17, LI cadherin (liver-intestine), cadherin-16, cadherin-17, CDH16, FLJ26931, HPT1, HPT-1, HPT-1 cadherin, human intestinal peptide-associated transporter HPT-1, human peptide transporter 1, Intestinal peptide-associated transporter HPT-1, LI cadherin, LI-cadherin, Liver-intestine cadherin, MGC138218, MGC142024 |
|---|
| Gene, Accession # | CDH17, Gene ID: 1015 |
|---|
| Catalog # | NBP1-88238 |
|---|
| Price | |
|---|
| Order / More Info | Cadherin-17 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 21677534 |
|---|
| 产品资料 |
|
|