| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Clathrin Heavy Chain 1/CHC17 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Clathrin Heavy Chain 1/CHC17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Clathrin Heavy Chain 1/CHC17. This antibody reacts with human. The Clathrin Heavy Chain 1/CHC17 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Clathrin Heavy Chain 1/CHC17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQ |
|---|
| Other Names | CHC, CHC17, clathrin heavy chain 1, Clathrin heavy chain on chromosome 17, clathrin, heavy chain, clathrin, heavy chain (Hc), clathrin, heavy polypeptide (Hc), clathrin, heavy polypeptide-like 2, CLH17, CLH-17, CLTCL2, Hc, KIAA0034 |
|---|
| Gene, Accession # | CLTC, Gene ID: 1213 |
|---|
| Catalog # | NBP2-49293 |
|---|
| Price | |
|---|
| Order / More Info | Clathrin Heavy Chain 1/CHC17 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|