| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Mitochondrial Ribosomal Protein S18C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Mitochondrial Ribosomal Protein S18C Antibody from Novus Biologicals is a rabbit polyclonal antibody to Mitochondrial Ribosomal Protein S18C. This antibody reacts with human. The Mitochondrial Ribosomal Protein S18C Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Mitochondrial Ribosomal Protein S18C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFM PVTYKDPAYLKDPKVCNIRYR |
|---|
| Other Names | 28S ribosomal protein S18c, mitochondrial, CGI-134, mitochondrial ribosomal protein S18-1, mitochondrial ribosomal protein S18C, MRP-S18-1, MRPS18-1, MRPS18-1mitochondrial, mrps18-c, MRP-S18-c, MRPS18C mitochondrial ribosomal protein S18C, S18mt-c |
|---|
| Gene, Accession # | MRPS18C, Gene ID: 51023 |
|---|
| Catalog # | NBP2-14807 |
|---|
| Price | |
|---|
| Order / More Info | Mitochondrial Ribosomal Protein S18C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|