| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP9A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP9A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP9A. This antibody reacts with human, mouse, rat. The ATP9A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat ATP9A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MTDNIPLQPVRQKKRMDSRPRAGCCEWLRCCGG |
|---|
| Other Names | ATPase class II type 9A, ATPase type IV, phospholipid-transporting (P-type), ATPase, class II, type 9A, ATPIIAphospholipid-transporting ATPase IIA, EC 3.6.3, EC 3.6.3.1, KIAA0611probable phospholipid-transporting ATPase IIA |
|---|
| Gene, Accession # | ATP9A, Gene ID: 10079 |
|---|
| Catalog # | NBP1-88905 |
|---|
| Price | |
|---|
| Order / More Info | ATP9A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|