| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Alkaline Phosphatase, Intestinal |
|---|
| Clone | 3A8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Alkaline Phosphatase, Intestinal Antibody (3A8) from Novus Biologicals is a mouse monoclonal antibody to Alkaline Phosphatase, Intestinal. This antibody reacts with human. The Alkaline Phosphatase, Intestinal Antibody (3A8) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ALPI (NP_001622 74 a.a. - 162 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSV |
|---|
| Other Names | alkaline phosphatase, intestinal, alkaline phosphomonoesterase, EC 3.1.3.1, glycerophosphatase, IAP, Intestinal alkaline phosphatase, intestinal-type alkaline phosphatase, Kasahara isozyme |
|---|
| Gene, Accession # | ALPI, Gene ID: 248, Accession: NP_001622, SwissProt: NP_001622 |
|---|
| Catalog # | H00000248-M03 |
|---|
| Price | |
|---|
| Order / More Info | Alkaline Phosphatase, Intestinal Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 20307659, 23593331, 24928904, 25603912 |
|---|
| 产品资料 |
|
|