| Edit |   |
| Antigenic Specificity | Adenosine Deaminase, RNA-Specific (ADAR) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ADAR is responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Immunogen | ADAR antibody was raised using the N terminal of ADAR corresponding to a region with amino acids GEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVS |
| Other Names | red1|drada|wu:fc22a02|adar1|dsRAD|dsRAD-1|ADAR|ADAR1|CG12598|Dmel\\CG12598|EG:BACN35H14.1|adar|adr|cg12598|dADAR|dAdar|hypnos-2|NV18763|AGS6|DRADA|DSH|DSRAD|G1P1|IFI-4|IFI4|K88DSRBP|P136|AV242451|Adar1|mZaADAR |
| Gene, Accession # | Gene ID: 103 |
| Catalog # | ABIN634454 |
| Price | |
| Order / More Info | Adenosine Deaminase, RNA-Specific (ADAR) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |