| Edit |   |
|---|
| Antigenic Specificity | Adenosine Deaminase, RNA-Specific, B2 (ADARB2) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ADARB2 is a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing. |
|---|
| Immunogen | ADARB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG |
|---|
| Other Names | Adar3|RED2|Red2|ADAR3|si:dkey-255g15.1 |
|---|
| Gene, Accession # | Gene ID: 105 |
|---|
| Catalog # | ABIN633530 |
|---|
| Price | |
|---|
| Order / More Info | Adenosine Deaminase, RNA-Specific, B2 (ADARB2) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|