| Edit |   |
|---|
| Antigenic Specificity | CCT3 |
|---|
| Clone | 12H4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal antibody to CCT3 |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ). |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | UniProt: P49368 |
|---|
| Catalog # | orb421126 |
|---|
| Price | |
|---|
| Order / More Info | CCT3 Antibody from BIORBYT LTD. |
|---|
| Product Specific References | n/a |
|---|