| Edit |   |
|---|
| Antigenic Specificity | Glyoxalase I (GLO1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere. |
|---|
| Immunogen | GLO1 antibody was raised using the N terminal of GLO1 corresponding to a region with amino acids TMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKE |
|---|
| Other Names | cb554|zgc:66035|wu:fb82g09|glod1|glyi|glo1|GLO1|ATGLX1|F12F1.32|F12F1_32|GLYOXALASE I|glyoxalase I homolog|trypanothione-dependent glyoxalase I|0610009E22Rik|1110008E19Rik|2510049H23Rik|AW550643|GLY1|Glo-1|Glo-1r|Glo-1s|Glo1-r|Glo1-s|Qglo|GLOD1|GLYI |
|---|
| Gene, Accession # | Gene ID: 2739,109801,294320 |
|---|
| Catalog # | ABIN631567 |
|---|
| Price | |
|---|
| Order / More Info | Glyoxalase I (GLO1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|