| Edit |   |
| Antigenic Specificity | LRP1B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 95%, rat 56%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human LRP1B polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GGPSAFKLPHTAPPIYLNSDLKGPLTAGPTNYSNPVYAKLYMDGQNCRNSLGSVDERKELLPKK |
| Other Names | low density lipoprotein receptor-related protein 1B, LRP-DIT, LRPDIT |
| Gene, Accession # | Gene ID: 53353, UniProt: Q9NZR2, ENSG00000168702 |
| Catalog # | HPA069094 |
| Price | |
| Order / More Info | LRP1B Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |