| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DDX46 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DDX46 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDX46. This antibody reacts with human, mouse, rat. The DDX46 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human, mouse, rat DDX46 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAM |
|---|
| Other Names | DEAD (Asp-Glu-Ala-Asp) box polypeptide 46, DEAD box protein 46, EC 3.6.1, EC 3.6.4.13, FLJ25329, KIAA0801probable ATP-dependent RNA helicase DDX46, MGC9936, Prp5, PRP5 homolog, Prp5-like DEAD-box protein, PRPF5, RNA helicase |
|---|
| Gene, Accession # | DDX46, Gene ID: 9879 |
|---|
| Catalog # | NBP1-83565 |
|---|
| Price | |
|---|
| Order / More Info | DDX46 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|