| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATPase, H+ Transporting, Lysosomal V0 Subunit A1 (ATP6V0A1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ATP6V0A1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. ATP6V0A1 is one of three A subunit proteins and it is associated with clathrin-coated vesicles. |
|---|
| Immunogen | ATP6 V6 1 antibody was raised using the N terminal of ATP6 6 1 corresponding to a region with amino acids RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE |
|---|
| Other Names | A1|ATP6N1|ATP6N1A|Stv1|VPP1|Vph1|a1|AA959968|ATP6a1|Atp6n1|Atp6n1a|Atpv0a1|Vpp-1|Vpp1 |
|---|
| Gene, Accession # | Gene ID: 535,11975,29757 |
|---|
| Catalog # | ABIN635431 |
|---|
| Price | |
|---|
| Order / More Info | ATPase, H+ Transporting, Lysosomal V0 Subunit A1 (ATP6V0A1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|