Edit |   |
Antigenic Specificity | ARR3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-ARR3 Antibody |
Immunogen | The immunogen for anti-ARR3 antibody: synthetic peptide directed towards the C terminal of human ARR3. Synthetic peptide located within the following region: DVGVELPLVLIHPKPSHEAASSEDIVIEEFTRKGEEESQKAVEAEGDEGS |
Other Names | ARRX, arrestin 3, retinal (X-arrestin) |
Gene, Accession # | ARRC, Accession: NM_004312 |
Catalog # | TA342722 |
Price | |
Order / More Info | ARR3 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |