| Edit |   |
|---|
| Antigenic Specificity | Endoplasmic Reticulum Lectin 1 (ERLEC1) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | C2orf30 is a probable lectin that binds selectively to improperly folded lumenal proteins. May function in endoplasmic reticulum quality control and endoplasmic reticulum-associated degradation (ERAD) of both non-glycosylated proteins and glycoproteins. |
|---|
| Immunogen | C2 orf30 antibody was raised using the middle region of C2 rf30 corresponding to a region with amino acids GKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTV |
|---|
| Other Names | C2orf30|CIM|CL24936|CL25084|XTP3-B|XTP3TPB|4933407N01Rik |
|---|
| Gene, Accession # | Gene ID: 27248 |
|---|
| Catalog # | ABIN632582 |
|---|
| Price | |
|---|
| Order / More Info | Endoplasmic Reticulum Lectin 1 (ERLEC1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|