| Edit |   |
|---|
| Antigenic Specificity | Lectin, Galactoside-Binding, Soluble, 9 (LGALS9) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS9 is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H+RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. |
|---|
| Immunogen | LGALS9 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH |
|---|
| Other Names | huat|lgals9a|ecalectin|galectin-9|Lgals9|wu:fd20c09|zgc:111833|LGALS9|AA407335|AI194909|AI265545|LGALS35|Lgals5|gal-9|HUAT|LGALS9A|UAT|UATP.I |
|---|
| Gene, Accession # | Gene ID: 3965 |
|---|
| Catalog # | ABIN634316 |
|---|
| Price | |
|---|
| Order / More Info | Lectin, Galactoside-Binding, Soluble, 9 (LGALS9) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|