Edit |   |
Antigenic Specificity | DACT3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | porcine, human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-DACT3 Antibody |
Immunogen | The immunogen for Anti-DACT3 antibody is: synthetic peptide directed towards the C-terminal region of Human DACT3. Synthetic peptide located within the following region: AAGRRGRMAEASGRRGSPRARKASRSQSETSLLGRASAVPSGPPKYPTAE |
Other Names | DAPPER3, RRR1, dishevelled-binding antagonist of beta-catenin 3 |
Gene, Accession # | DACT3, Accession: NM_145056 |
Catalog # | TA331391 |
Price | |
Order / More Info | DACT3 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |