| Edit |   |
| Antigenic Specificity | ZNF833P |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-ZNF833P Antibody |
| Immunogen | The immunogen for anti-ZNF833P antibody: synthetic peptide directed towards the N terminal of human LOC401898. Synthetic peptide located within the following region: MVMHSEDEPYKCKFCGKAFDNLHLYLTHERTHTGEKPYECNKCGKAFSCS |
| Other Names | ZNF833, zinc finger protein 833, pseudogene |
| Gene, Accession # | ZN833, Accession: NM_001013691 |
| Catalog # | TA342136 |
| Price | |
| Order / More Info | ZNF833P Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |