| Edit |   |
|---|
| Antigenic Specificity | Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GAPDHS is a protein belonging to the glyceraldehyde-3-phosphate dehydrogenase family of enzymes that play an important role in carbohydrate metabolism. |
|---|
| Immunogen | GAPDHS antibody was raised using the N terminal of GAPDHS corresponding to a region with amino acids PFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQI |
|---|
| Other Names | GAPDS|GAPDHS|GAPD2|GAPDH-2|HSD-35|Gapd-s|Gapds|gapdh-2|cb350|fb71f08|fk58c09|g3pdh|gapdh|gapds|wu:fb71f08|wu:fk58c09|zgc:76908 |
|---|
| Gene, Accession # | Gene ID: 26330 |
|---|
| Catalog # | ABIN631607 |
|---|
| Price | |
|---|
| Order / More Info | Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|