| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Blk |
|---|
| Clone | 7A12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Flow Cytometry, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for ELISA. FACS usage was reported in scientific literature. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Blk Antibody (7A12) from Novus Biologicals is a mouse monoclonal antibody to Blk. This antibody reacts with human, mouse, rat. The Blk Antibody (7A12) has been validated for the following applications: Western Blot, Flow Cytometry, ELISA. |
|---|
| Immunogen | BLK (AAH07371, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKG |
|---|
| Other Names | B lymphocyte kinase, B lymphoid tyrosine kinase, BLK nonreceptor tyrosine kinase, EC 2.7.10.2, MGC10442, MODY11, p55-Blk, tyrosine-protein kinase Blk |
|---|
| Gene, Accession # | BLK, Gene ID: 640, Accession: AAH07371, SwissProt: AAH07371 |
|---|
| Catalog # | H00000640-M02 |
|---|
| Price | |
|---|
| Order / More Info | Blk Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 21978998, 22678060, 23555801 |
|---|
| 产品资料 |
|
|