| Edit |   |
| Antigenic Specificity | G-2 and S-Phase Expressed 1 (GTSE1) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | GTSE1 is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor suppressor protein p53, shuttling it out of the nucleus and repressing its ability to induce apoptosis. |
| Immunogen | GTSE1 antibody was raised using the middle region of GTSE1 corresponding to a region with amino acids IDLMTNTPDMNKNVAKPSPVVGQLIDLSSPLIQLSPEADKENVDSPLLKF |
| Other Names | gtse1|MGC81588|MGC89498|GTSE1|fb70b04|fj88g09|wu:fb70b04|wu:fj88g09|wu:fy65d12|MGC114722|B99|Gtse-1|RGD1563164 |
| Gene, Accession # | Gene ID: 51512,29870,300126 |
| Catalog # | ABIN634185 |
| Price | |
| Order / More Info | G-2 and S-Phase Expressed 1 (GTSE1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |