| Edit |   |
|---|
| Antigenic Specificity | Acyl-CoA Dehydrogenase, Long Chain (ACADL) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in ACADL gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia. |
|---|
| Immunogen | ACADL antibody was raised using the N terminal of ACADL corresponding to a region with amino acids MAARLLRGSLRVLGGHRAPRQLPAARCSHSGGEERLETPSAKKLTDIGIR |
|---|
| Other Names | zgc:55656|ACAD4|LCAD|ACOADA|AA960361|AU018452|C79855 |
|---|
| Gene, Accession # | Gene ID: 33 |
|---|
| Catalog # | ABIN631116 |
|---|
| Price | |
|---|
| Order / More Info | Acyl-CoA Dehydrogenase, Long Chain (ACADL) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|