| Edit |   |
| Antigenic Specificity | Deoxycytidylate deaminase |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Deoxycytidylate deaminase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Deoxycytidylate deaminase. This antibody reacts with human. The Deoxycytidylate deaminase Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to DCTD(dCMP deaminase) The peptide sequence was selected from the middle region of DCTD. Peptide sequence MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL. |
| Other Names | dCMP deaminaseEC 3.5.4.12, deoxycytidylate deaminase, MGC111062 |
| Gene, Accession # | DCTD, Gene ID: 1635, Accession: D3DP49, SwissProt: D3DP49 |
| Catalog # | NBP1-57825 |
| Price | |
| Order / More Info | Deoxycytidylate deaminase Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |