| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 4 (SLC25A4) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy. |
|---|
| Immunogen | SLC25 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT |
|---|
| Other Names | ant|ant1|peo2|peo3|MANT1|AU019225|Ant1|1|AAC1|ANT|ANT 1|ANT1|PEO2|PEO3|T1|SLC25A5 |
|---|
| Gene, Accession # | Gene ID: 291 |
|---|
| Catalog # | ABIN635077 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 4 (SLC25A4) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|