| Edit |   |
| Antigenic Specificity | Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 6 (SLC25A6) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC25A6 catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. SLC25A6 may participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis. |
| Immunogen | SLC25 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ |
| Other Names | wu:fj78b08|si:dkey-21o13.4|SLC25A6|SLC25A6P|4930433D19Rik|4933433F13Rik|AW557176|D6Bwg0781e|Slc25a6|SLC25A5|2|3|AAC3|ANT|ANT 2|ANT 3|ANT3|ANT3Y|RGD1560896 |
| Gene, Accession # | Gene ID: 293 |
| Catalog # | ABIN635039 |
| Price | |
| Order / More Info | Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 6 (SLC25A6) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |