| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC25 family is mitochondrial carriers that transport a variety of metabolites across the inner mitochondrial membrane. SLC25A22, also known as GC1, is 1 of the 2 mitochondrial glutamate/H+ symporters, the other being SLC25A18. |
|---|
| Immunogen | SLC25 A22 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV |
|---|
| Other Names | 1300006L01Rik|AI060884|Gc1|GC1|RGD1307826|EIEE3|NET44 |
|---|
| Gene, Accession # | Gene ID: 79751 |
|---|
| Catalog # | ABIN635084 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|