| Edit |   |
|---|
| Antigenic Specificity | RRP1B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RRP1B Antibody from Novus Biologicals is a rabbit polyclonal antibody to RRP1B. This antibody reacts with human. The RRP1B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human RRP1B. Peptide sequence VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP. |
|---|
| Other Names | Nnp1, ribosomal RNA processing 1 homolog B (S. cerevisiae), RRP1 |
|---|
| Gene, Accession # | RRP1B, Gene ID: 23076, Accession: NP_055871, SwissProt: NP_055871 |
|---|
| Catalog # | NBP1-80553 |
|---|
| Price | |
|---|
| Order / More Info | RRP1B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|