| Edit |   |
|---|
| Antigenic Specificity | Cartilage Acidic Protein 1 (CRTAC1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of CRTAC protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | CRTAC1 antibody was raised using the N terminal of CRTAC1 corresponding to a region with amino acids FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK |
|---|
| Other Names | ASPIP|cb184|crtac1|sb:cb184|zgc:165343|aspic1|cep-68|MGC146658|ASPIC|ASPIC1|CEP-68|2810454P21Rik|AW047536|Crtac1B|Lotus|W307 |
|---|
| Gene, Accession # | Gene ID: 55118 |
|---|
| Catalog # | ABIN632560 |
|---|
| Price | |
|---|
| Order / More Info | Cartilage Acidic Protein 1 (CRTAC1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|