| Edit |   |
|---|
| Antigenic Specificity | Cartilage Associated Protein (CRTAP) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The protein encoded by this gene is similar to the chicken and mouse CRTAP genes. The encoded protein is a scaffolding protein that may influence the activity of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli. |
|---|
| Immunogen | CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF |
|---|
| Other Names | zgc:85621|wu:fb47h01|CASP|LEPREL3|OI7|5730529N23Rik|Leprel3|RGD1565180 |
|---|
| Gene, Accession # | Gene ID: 10491 |
|---|
| Catalog # | ABIN635556 |
|---|
| Price | |
|---|
| Order / More Info | Cartilage Associated Protein (CRTAP) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|