| Edit |   |
|---|
| Antigenic Specificity | Exosome Component 10 (EXOSC10) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | EXOSC10 contains 1 HRDC domain and 1 3'-5' exonuclease domain. Antibodies against PM/SCL are found in patients with polymyositis and/or scleroderma. |
|---|
| Immunogen | EXOSC10 antibody was raised using the C terminal of EXOSC10 corresponding to a region with amino acids FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG |
|---|
| Other Names | Pmscl2|zgc:55695|pm-scl|pm/scl-100|pmscl|pmscl2|rrp6|rrp6p|EXOSC10|201.t00018|21.m02990|DDBDRAFT_0203581|DDBDRAFT_0233752|DDB_0203581|DDB_0233752|PM-Scl|PM/Scl-100|PMSCL|PMSCL2|RRP6|Rrp6p|p2|p3|p4 |
|---|
| Gene, Accession # | Gene ID: 5394 |
|---|
| Catalog # | ABIN629904 |
|---|
| Price | |
|---|
| Order / More Info | Exosome Component 10 (EXOSC10) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|