| Edit |   |
|---|
| Antigenic Specificity | Exosome Component 3 (EXOSC3) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. |
|---|
| Immunogen | EXOSC3 antibody was raised using the C terminal of EXOSC3 corresponding to a region with amino acids VIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQAISSRL |
|---|
| Other Names | PCH1B|RP11-3J10.8|RRP40|Rrp40p|bA3J10.7|hRrp-40|p10|2310005D06Rik|AI593501|Rrp40|im:7140537|zgc:112345 |
|---|
| Gene, Accession # | Gene ID: 51010 |
|---|
| Catalog # | ABIN633247 |
|---|
| Price | |
|---|
| Order / More Info | Exosome Component 3 (EXOSC3) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|