| Edit |   |
|---|
| Antigenic Specificity | Exosome Component 2 (EXOSC2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity. |
|---|
| Immunogen | EXOSC2 antibody was raised using the N terminal of EXOSC2 corresponding to a region with amino acids RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV |
|---|
| Other Names | EXOSC2|exosc2|MGC97533|RRP4|Rrp4p|hRrp4p|p7|Rrp4|fa97b01|wu:fa97b01|zgc:110117 |
|---|
| Gene, Accession # | Gene ID: 23404 |
|---|
| Catalog # | ABIN629917 |
|---|
| Price | |
|---|
| Order / More Info | Exosome Component 2 (EXOSC2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|