| Edit |   |
|---|
| Antigenic Specificity | Exosome Component 7 (EXOSC7) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3'-untranslated regions. The protein is required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA. |
|---|
| Immunogen | EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC |
|---|
| Other Names | EXOSC7|zgc:110717|EAP1|RRP42|Rrp42p|hRrp42p|p8|2610002K22Rik|AV212732|mKIAA0116 |
|---|
| Gene, Accession # | Gene ID: 23016,66446 |
|---|
| Catalog # | ABIN633320 |
|---|
| Price | |
|---|
| Order / More Info | Exosome Component 7 (EXOSC7) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|