| Edit |   |
| Antigenic Specificity | Exosome Component 7 (EXOSC7) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat, dog |
| Isotype | n/a |
| Format | purified |
| Size | 100 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. |
| Immunogen | EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD |
| Other Names | EXOSC7|zgc:110717|EAP1|RRP42|Rrp42p|hRrp42p|p8|2610002K22Rik|AV212732|mKIAA0116 |
| Gene, Accession # | Gene ID: 23016,476654,66446,316098 |
| Catalog # | ABIN629910 |
| Price | |
| Order / More Info | Exosome Component 7 (EXOSC7) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |