| Edit |   |
|---|
| Antigenic Specificity | Glycyl-tRNA Synthetase (GARS) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GARS catalyzes the attachment of glycine to tRNA(Gly). Is also able produce diadenosine tetraphosphate (Ap4A), a universal pleiotropic signaling molecule needed for cell regulation pathways, by direct condensation of 2 ATPs. |
|---|
| Immunogen | GARS antibody was raised using the middle region of GARS corresponding to a region with amino acids IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN |
|---|
| Other Names | Aat-gly|CG6778|Dmel\\CG6778|GRS|GlyRS|gars|team|GB13467|MGC79495|CMT2D|DSMAV|HMN5|SMAD1|GENA202|Gena201|Nmf249|Sgrp23|RGD1559871|fb02f03|si:dkey-276i5.1|wu:fb02f03 |
|---|
| Gene, Accession # | Gene ID: 2617,353172,297113 |
|---|
| Catalog # | ABIN630934 |
|---|
| Price | |
|---|
| Order / More Info | Glycyl-tRNA Synthetase (GARS) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|