| Edit |   |
|---|
| Antigenic Specificity | Aldo-Keto Reductase Family 7, Member A3 (Aflatoxin Aldehyde Reductase) (AKR7A3) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones. |
|---|
| Immunogen | AKR7 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW |
|---|
| Other Names | AFAR2|fd56g11|wu:fd56g11|zgc:92502|AKR7A2|Afar|Akr7a1 |
|---|
| Gene, Accession # | Gene ID: 22977 |
|---|
| Catalog # | ABIN632796 |
|---|
| Price | |
|---|
| Order / More Info | Aldo-Keto Reductase Family 7, Member A3 (Aflatoxin Aldehyde Reductase) (AKR7A3) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|