| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AKT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AKT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AKT2. This antibody reacts with human. The AKT2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human AKT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMND |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.1, Murine thymoma viral (v-akt) homolog-2, PKB beta, PKBB, PKBBETA, PRKBB, Protein kinase Akt-2, Protein kinase B beta, rac protein kinase beta, RAC-BETA, RAC-beta serine/threonine-protein kinase, RAC-PK-beta, v-akt murine thymoma viral oncogene homolog 2 |
|---|
| Gene, Accession # | AKT2, Gene ID: 208 |
|---|
| Catalog # | NBP2-55812 |
|---|
| Price | |
|---|
| Order / More Info | AKT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|