| Edit |   |
|---|
| Antigenic Specificity | Early Growth Response 1 (EGR1) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins. |
|---|
| Immunogen | EGR1 antibody was raised using the middle region of EGR1 corresponding to a region with amino acids PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS |
|---|
| Other Names | EGR-1|Egr1|AT225|G0S30|KROX-24|NGFI-A|TIS8|ZIF-268|ZNF225|A530045N19Rik|ETR103|Egr-1|Krox-1|Krox-24|Krox24|NGF1-A|NGFIA|Zenk|Zfp-6|Zif268|egr|Ngf1|Ngfi|zif-268|krox-24|krox24|wu:fj64b05|wu:fq25f01|zenk|EGR-1-A|Xegr-1|at225|egr-1|egr1|g0s30|ngfi-a|tis8|znf225|EGR1 |
|---|
| Gene, Accession # | Gene ID: 1958 |
|---|
| Catalog # | ABIN630613 |
|---|
| Price | |
|---|
| Order / More Info | Early Growth Response 1 (EGR1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|