| Edit |   |
|---|
| Antigenic Specificity | AMN1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AMN1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AMN1. This antibody reacts with human. The AMN1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to AMN1(antagonist of mitotic exit network 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of AMN1. Peptide sequence PRPRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQIT. |
|---|
| Other Names | antagonist of mitotic exit network 1 homolog (S. cerevisiae), protein AMN1 homolog |
|---|
| Gene, Accession # | AMN1, Gene ID: 196394, Accession: Q8IY45, SwissProt: Q8IY45 |
|---|
| Catalog # | NBP1-56931 |
|---|
| Price | |
|---|
| Order / More Info | AMN1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|