| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PIM1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (predicted: bovine) |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for Serine/threonine-protein kinase pim-1(PIM1) detection. Tested with WB in Human. No cross reactivity with other proteins. Proto-oncogene serine/threonine-protein kinase Pim-1 is an enzyme that in humans is encoded by the PIM1 gene. It is mapped to 6p21.2. Primarily expressed in spleen, thymus, bone marrow, prostate, oral epithelial, hippocampus and fetal liver cells, Pim-1 has also been found to be highly expressed in cell cultures isolated from human tumors. Pim-1 is mainly involved in cell cycle progression, apoptosis and transcriptional activation, as well as more general signal transduction pathways. It has been found a physiologic role of the PIM1 oncogene during hematopoietic development and a deregulation of the gene in various leukemias. PIM1 also has a role in cardioprotection downstream of AKT activation. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human PIM1(373-404aa EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK), different from the related mouse sequence by seven amino acids and from the related rat sequence by two amino acids. |
|---|
| Other Names | Serine/threonine-protein kinase pim-1;2.7.11.1;PIM1; |
|---|
| Gene, Accession # | PIM1, UniProt: P11309 |
|---|
| Catalog # | PB9315 |
|---|
| Price | |
|---|
| Order / More Info | PIM1 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|