| Edit |   |
|---|
| Antigenic Specificity | Cholinergic Receptor, Nicotinic, alpha 1 (Muscle) (CHRNA1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 CHRNA1 encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. |
|---|
| Immunogen | CHRNA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNV |
|---|
| Other Names | CHRNA1|ACHRA|ACHRD|CHRNA|CMS2A|FCCMS|SCCMS|NACHRA1|AI385656|AI608266|Achr-1|Acra |
|---|
| Gene, Accession # | Gene ID: 1134 |
|---|
| Catalog # | ABIN633174 |
|---|
| Price | |
|---|
| Order / More Info | Cholinergic Receptor, Nicotinic, alpha 1 (Muscle) (CHRNA1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|