| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cholinergic Receptor, Nicotinic, alpha 7 (Neuronal) (CHRNA7) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The protein encoded by CHRNA7 displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. |
|---|
| Immunogen | CHRNA7 antibody was raised using the middle region of CHRNA7 corresponding to a region with amino acids VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF |
|---|
| Other Names | CHRNA7-2|NACHRA7|BTX|NARAD|nAChRa7|Acra7|alpha7 |
|---|
| Gene, Accession # | Gene ID: 1139 |
|---|
| Catalog # | ABIN630113 |
|---|
| Price | |
|---|
| Order / More Info | Cholinergic Receptor, Nicotinic, alpha 7 (Neuronal) (CHRNA7) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|