| Edit |   |
|---|
| Antigenic Specificity | CD99 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 34%, rat 34%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human CD99 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLL |
|---|
| Other Names | CD99 molecule, MIC2 |
|---|
| Gene, Accession # | Gene ID: 4267, UniProt: P14209, ENSG00000002586 |
|---|
| Catalog # | HPA035304 |
|---|
| Price | |
|---|
| Order / More Info | CD99 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|