| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GNB1L is a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. Therefore, this gene may contribute to the etiology of those disorders. |
|---|
| Immunogen | GNB1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids RVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA |
|---|
| Other Names | GBL|fi37e04|gbl|wu:fi37e04|zgc:55455|zgc:85668|GNB1L|zgc:110763|DGCRK3|GY2|WDR14|WDVCF|ESTM55|Gm16314|Me49f07|OTTMUSG00000033458|Wdr14|Wdvcf |
|---|
| Gene, Accession # | Gene ID: 54584,13972,680266 |
|---|
| Catalog # | ABIN630215 |
|---|
| Price | |
|---|
| Order / More Info | Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|