| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD40/TNFRSF5 |
|---|
| Clone | CL1673 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD40/TNFRSF5 Antibody (CL1673) from Novus Biologicals is a mouse monoclonal antibody to CD40/TNFRSF5. This antibody reacts with human. The CD40/TNFRSF5 Antibody (CL1673) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CD40/TNFRSF5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCE |
|---|
| Other Names | B cell surface antigen CD40, B-cell surface antigen CD40, Bp50B cell-associated molecule, CD40 antigen, CD40 molecule, TNF receptor superfamily member 5, CD40 type II isoform, CD40L receptor, CDw40, MGC9013, nerve growth factor receptor-related B-lymphocyte activation molecule, p50, TNFRSF5CD40 antigen (TNF receptor superfamily member 5), tumor necrosis factor receptor superfamily member 5, tumor necrosis factor receptor superfamily, member 5 |
|---|
| Gene, Accession # | CD40, Gene ID: 958, Accession: P25942, SwissProt: P25942 |
|---|
| Catalog # | NBP2-34488 |
|---|
| Price | |
|---|
| Order / More Info | CD40/TNFRSF5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|